Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TAF4 polyclonal antibody (A01)

  • Catalog # : H00006874-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TAF4.
  • Immunogen:
  • TAF4 (NP_003176, 715 a.a. ~ 800 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006874-A01
    Western Blot detection against Immunogen (35.57 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6874
  • Gene Name:
  • TAF4
  • Gene Alias:
  • FLJ41943,TAF2C,TAF2C1,TAF4A,TAFII130,TAFII135
  • Gene Description:
  • TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
  • Gene Summary:
  • Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases. [provided by RefSeq
  • Other Designations:
  • TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135 kD,TAF4A RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135 kD,TATA box binding protein (TBP)-associated factor, RNA polymerase II, C1, 130kD,TBP-associate
  • RSS
  • YouTube
  • Linkedin
  • Facebook