Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TACR1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006869-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TACR1 partial ORF ( NP_001049, 140 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.18
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006869-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6869
  • Gene Name:
  • TACR1
  • Gene Alias:
  • NK1R,NKIR,SPR,TAC1R
  • Gene Description:
  • tachykinin receptor 1
  • Gene Summary:
  • This gene belongs to a gene family of tachykinin receptors. These tachykinin receptors are characterized by interactions with G proteins and contain seven hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, also referred to as neurokinin 1. The encoded protein is also involved in the mediation of phosphatidylinositol metabolism of substance P. [provided by RefSeq
  • Other Designations:
  • NK-1 receptor,neurokinin 1 receptor,tachykinin 1 receptor (substance P receptor, neurokinin 1 receptor),tachykinin receptor 1 (substance P receptor; neurokinin-1 receptor)
  • RSS
  • YouTube
  • Linkedin
  • Facebook