Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TACR1 (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00006869-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TACR1 full-length ORF (NP_056542.1) recombinant protein without tag.
  • Sequence:
  • MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.7
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 6869
  • Gene Name:
  • TACR1
  • Gene Alias:
  • NK1R,NKIR,SPR,TAC1R
  • Gene Description:
  • tachykinin receptor 1
  • Gene Summary:
  • This gene belongs to a gene family of tachykinin receptors. These tachykinin receptors are characterized by interactions with G proteins and contain seven hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, also referred to as neurokinin 1. The encoded protein is also involved in the mediation of phosphatidylinositol metabolism of substance P. [provided by RefSeq
  • Other Designations:
  • NK-1 receptor,neurokinin 1 receptor,tachykinin 1 receptor (substance P receptor, neurokinin 1 receptor),tachykinin receptor 1 (substance P receptor; neurokinin-1 receptor)
  • RSS
  • YouTube
  • Linkedin
  • Facebook