SURF5 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MED22 expression in transfected 293T cell line (H00006837-T01) by MED22 MaxPab polyclonal antibody.
Lane 1: SURF5 transfected lysate(15.4 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SURF5 protein.
Immunogen
SURF5 (NP_852468, 1 a.a. ~ 140 a.a) full-length human protein.
Sequence
MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MED22 expression in transfected 293T cell line (H00006837-T01) by MED22 MaxPab polyclonal antibody.
Lane 1: SURF5 transfected lysate(15.4 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MED22
Entrez GeneID
6837GeneBank Accession#
NM_181491Protein Accession#
NP_852468Gene Name
MED22
Gene Alias
MED24, MGC48682, SURF5
Gene Description
mediator complex subunit 22
Omim ID
185641Gene Ontology
HyperlinkGene Summary
This gene is located in the surfeit gene cluster, a group of very tightly linked housekeeping genes that do not share sequence similarity. The gene is oriented in a head-to-head fashion with RPL7A (SURF3) and the two genes share a bidirectional promoter. The encoded proteins are localized to the cytoplasm. Two alternative transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022480|surfeit 5|surfeit locus protein 5
-
Interactome
-
Disease
-
Publication Reference
-
Adenovirus L-E1A activates transcription through mediator complex dependent recruitment of the super elongation complex.
Vijayalingam S, Chinnadurai G.
Journal of Virology 2013 Jan; 87(6):3425.
Application：WB, Human, Human KB cell.
-
Adenovirus L-E1A activates transcription through mediator complex dependent recruitment of the super elongation complex.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com