Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SULT1A3 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00006818-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SULT1A3 protein.
  • Immunogen:
  • SULT1A3 (NP_003157.1, 1 a.a. ~ 295 a.a) full-length human protein.
  • Sequence:
  • MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SULT1A3 MaxPab polyclonal antibody. Western Blot analysis of SULT1A3 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SULT1A3 MaxPab polyclonal antibody. Western Blot analysis of SULT1A3 expression in HepG2.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SULT1A3 expression in transfected 293T cell line (H00006818-T02) by SULT1A3 MaxPab polyclonal antibody.

    Lane 1: SULT1A3 transfected lysate(32.45 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6818
  • Gene Name:
  • SULT1A3
  • Gene Alias:
  • HAST,HAST3,M-PST,MGC117469,ST1A5,STM,SULT1A4,TL-PST
  • Gene Description:
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3
  • Gene Summary:
  • Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Exons of this gene overlap with exons of a gene that encodes a protein containing GIY-YIG domains (GIYD1). Multiple alternatively spliced variants that encode the same protein have been described. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000045747,aryl sulfotransferase,catecholamine-sulfating phenol sulfotransferase,dopamine-specific sulfotransferase,monoamine-preferring sulfotransferase,monoamine-sulfating phenosulfotransferase,phenol sulfotransferase 1A5*4,placental estrogen su
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook