Product Browser

Last updated: 2017/3/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SULT1A1 monoclonal antibody (M01A), clone 1F8

  • Catalog # : H00006817-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant SULT1A1.
  • Immunogen:
  • SULT1A1 (AAH00923, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006817-M01A
    Western Blot detection against Immunogen (58.19 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SULT1A1 expression in transfected 293T cell line by SULT1A1 monoclonal antibody (M01A), clone 1F8.

    Lane 1: SULT1A1 transfected lysate(33.925 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of SULT1A1 transfected lysate using anti-SULT1A1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SULT1A1 monoclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6817
  • Gene Name:
  • SULT1A1
  • Gene Alias:
  • HAST1/HAST2,MGC131921,MGC5163,P-PST,PST,ST1A3,STP,STP1,TSPST1
  • Gene Description:
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1
  • Gene Summary:
  • Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000162569,aryl sulfotransferase,phenol-preferring phenol sulfotransferase1,phenol-sulfating phenol sulfotransferase,thermostable phenol sulfotransferase1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook