STXBP1 monoclonal antibody (M01), clone 6D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STXBP1 monoclonal antibody (M01), clone 6D1. Western Blot analysis of STXBP1 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
STXBP1 monoclonal antibody (M01), clone 6D1 Western Blot analysis of STXBP1 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
STXBP1 monoclonal antibody (M01), clone 6D1. Western Blot analysis of STXBP1 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of STXBP1 expression in transfected 293T cell line by STXBP1 monoclonal antibody (M01), clone 6D1.
Lane 1: STXBP1 transfected lysate (Predicted MW: 68.7 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STXBP1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STXBP1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.19 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STXBP1.
Immunogen
STXBP1 (NP_003156, 74 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STXBP1 monoclonal antibody (M01), clone 6D1. Western Blot analysis of STXBP1 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
STXBP1 monoclonal antibody (M01), clone 6D1 Western Blot analysis of STXBP1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
STXBP1 monoclonal antibody (M01), clone 6D1. Western Blot analysis of STXBP1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of STXBP1 expression in transfected 293T cell line by STXBP1 monoclonal antibody (M01), clone 6D1.
Lane 1: STXBP1 transfected lysate (Predicted MW: 68.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STXBP1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STXBP1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — STXBP1
Entrez GeneID
6812GeneBank Accession#
NM_003165Protein Accession#
NP_003156Gene Name
STXBP1
Gene Alias
EIEE4, MUNC18-1, UNC18, hUNC18, rbSec1
Gene Description
syntaxin binding protein 1
Omim ID
602926Gene Ontology
HyperlinkOther Designations
OTTHUMP00000022196|OTTHUMP00000022197|syntaxin-binding protein 1
-
Interactome
-
Disease
-
Publication Reference
-
Myosin Va, a Novel Interaction Partner of STXBP1, Is Required to Transport Syntaxin1A to the Plasma Membrane.
Yoshihiro Taura, Takenori Tozawa, Takahiro Fujimoto, Eisuke Ichise, Tomohiro Chiyonobu, Kyoko Itoh, Tomoko Iehara.
Neuroscience 2023 Jun; 524:256.
Application：IF, Mouse, Mouse hippocampal neurons.
-
MUNC18-1 gene abnormalities are involved in neurodevelopmental disorders through defective cortical architecture during brain development.
Hamada N, Iwamoto I, Tabata H, Nagata KI.
Acta Neuropathologica Communications 2017 Nov; 5(1):92.
Application：IF, Mouse, Mouse brain.
-
Myosin Va, a Novel Interaction Partner of STXBP1, Is Required to Transport Syntaxin1A to the Plasma Membrane.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com