STX4A monoclonal antibody (M04), clone 6D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STX4A monoclonal antibody (M04), clone 6D1. Western Blot analysis of STX4A expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
STX4A monoclonal antibody (M04), clone 6D1 Western Blot analysis of STX4A expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
STX4A monoclonal antibody (M04), clone 6D1. Western Blot analysis of STX4A expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of STX4 expression in transfected 293T cell line by STX4A monoclonal antibody (M04), clone 6D1.
Lane 1: STX4 transfected lysate (Predicted MW: 34.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STX4A is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to STX4A on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.85 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STX4A.
Immunogen
STX4A (NP_004595, 19 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STX4A monoclonal antibody (M04), clone 6D1. Western Blot analysis of STX4A expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
STX4A monoclonal antibody (M04), clone 6D1 Western Blot analysis of STX4A expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
STX4A monoclonal antibody (M04), clone 6D1. Western Blot analysis of STX4A expression in NIH/3T3(Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of STX4 expression in transfected 293T cell line by STX4A monoclonal antibody (M04), clone 6D1.
Lane 1: STX4 transfected lysate (Predicted MW: 34.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STX4A is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to STX4A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — STX4
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com