Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STX4A polyclonal antibody (A01)

  • Catalog # : H00006810-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant STX4A.
  • Immunogen:
  • STX4A (NP_004595, 19 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006810-A01
    Western Blot detection against Immunogen (37.22 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STX4A polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of STX4A expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STX4A polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of STX4A expression in HepG2.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STX4A polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of STX4A expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • STX4A polyclonal antibody (A01), Lot # 060525JCS1. Western Blot analysis of STX4A expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6810
  • Gene Name:
  • STX4
  • Gene Alias:
  • STX4A,p35-2
  • Gene Description:
  • syntaxin 4
  • Other Designations:
  • syntaxin 4A (placental)
  • RSS
  • YouTube
  • Linkedin
  • Facebook