STX1A monoclonal antibody (M02), clone 1B11-1A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STX1A monoclonal antibody (M02), clone 1B11-1A8. Western Blot analysis of STX1A expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
STX1A monoclonal antibody (M02), clone 1B11-1A8 Western Blot analysis of STX1A expression in IMR-32 ( Cat # L008V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of STX1A expression in transfected 293T cell line by STX1A monoclonal antibody (M02), clone 1B11-1A8.
Lane 1: STX1A transfected lysate(29 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STX1A is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to STX1A on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (53.35 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant STX1A.
Immunogen
STX1A (AAH03011.1, 1 a.a. ~ 251 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (53.35 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STX1A monoclonal antibody (M02), clone 1B11-1A8. Western Blot analysis of STX1A expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
STX1A monoclonal antibody (M02), clone 1B11-1A8 Western Blot analysis of STX1A expression in IMR-32 ( Cat # L008V1 ).Western Blot (Transfected lysate)
Western Blot analysis of STX1A expression in transfected 293T cell line by STX1A monoclonal antibody (M02), clone 1B11-1A8.
Lane 1: STX1A transfected lysate(29 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STX1A is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to STX1A on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — STX1A
Entrez GeneID
6804GeneBank Accession#
BC003011.1Protein Accession#
AAH03011.1Gene Name
STX1A
Gene Alias
HPC-1, STX1, p35-1
Gene Description
syntaxin 1A (brain)
Omim ID
186590Gene Ontology
HyperlinkGene Summary
Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com