Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STK3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006788-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human STK3 partial ORF ( NP_006272.1, 253 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006788-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6788
  • Gene Name:
  • STK3
  • Gene Alias:
  • FLJ90748,KRS1,MST2
  • Gene Description:
  • serine/threonine kinase 3 (STE20 homolog, yeast)
  • Gene Summary:
  • Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand (MIM 134638) (Taylor et al., 1996 [PubMed 8816758]; Lee et al., 2001 [PubMed 11278283]).[supplied by OMIM
  • Other Designations:
  • serine/threonine kinase 3 (Ste20, yeast homolog)
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook