STK3 monoclonal antibody (M13A), clone 4F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STK3 monoclonal antibody (M13A), clone 4F7. Western Blot analysis of STK3 expression in HepG2(Cat # L019V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of STK3 expression in transfected 293T cell line by STK3 monoclonal antibody (M13A), clone 4F7.
Lane 1: STK3 transfected lysate(56.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (38.94 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STK3.
Immunogen
STK3 (AAH10640.1, 311 a.a. ~ 431 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKV
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.94 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STK3 monoclonal antibody (M13A), clone 4F7. Western Blot analysis of STK3 expression in HepG2(Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of STK3 expression in transfected 293T cell line by STK3 monoclonal antibody (M13A), clone 4F7.
Lane 1: STK3 transfected lysate(56.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — STK3
Entrez GeneID
6788GeneBank Accession#
BC010640Protein Accession#
AAH10640.1Gene Name
STK3
Gene Alias
FLJ90748, KRS1, MST2
Gene Description
serine/threonine kinase 3 (STE20 homolog, yeast)
Omim ID
605030Gene Ontology
HyperlinkGene Summary
Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand (MIM 134638) (Taylor et al., 1996 [PubMed 8816758]; Lee et al., 2001 [PubMed 11278283]).[supplied by OMIM
Other Designations
serine/threonine kinase 3 (Ste20, yeast homolog)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com