Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ELOVL4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006785-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ELOVL4 partial ORF ( NP_073563, 99 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006785-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6785
  • Gene Name:
  • ELOVL4
  • Gene Alias:
  • ADMD,FLJ17667,FLJ92876,STGD2,STGD3
  • Gene Description:
  • elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4
  • Gene Summary:
  • This gene encodes a membrane-bound protein which is a member of the ELO family, proteins which participate in the biosynthesis of fatty acids. Consistent with the expression of the encoded protein in photoreceptor cells of the retina, mutations and small deletions in this gene are associated with Stargardt-like macular dystrophy (STGD3) and autosomal dominant Stargardt-like macular dystrophy (ADMD), also referred to as autosomal dominant atrophic macular degeneration. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016776,Stargardt disease 3 (autosomal dominant),elongation of very long chain fatty acids-like 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook