Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ST14 polyclonal antibody (A01)

  • Catalog # : H00006768-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ST14.
  • Immunogen:
  • ST14 (NP_068813, 298 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006768-A01
    Western Blot detection against Immunogen (37.44 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6768
  • Gene Name:
  • ST14
  • Gene Alias:
  • HAI,MT-SP1,MTSP-1,MTSP1,PRSS14,SNC19,TADG-15
  • Gene Description:
  • suppression of tumorigenicity 14 (colon carcinoma)
  • Gene Summary:
  • The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. [provided by RefSeq
  • Other Designations:
  • epithin,matriptase,membrane-type serine protease,serine protease TADG-15,suppression of tumorigenicity 14,suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin),tumor associated differentially expressed gene 15 protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook