ST13 monoclonal antibody (M02), clone 2B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ST13 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (32.12 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ST13.
Immunogen
ST13 (AAH15317, 1 a.a. ~ 58 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.12 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ST13 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ST13
Entrez GeneID
6767GeneBank Accession#
BC015317Protein Accession#
AAH15317Gene Name
ST13
Gene Alias
AAG2, FAM10A1, FAM10A4, FLJ27260, HIP, HOP, HSPABP, HSPABP1, MGC129952, P48, PRO0786, SNC6
Gene Description
suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
Omim ID
606796Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene. [provided by RefSeq
Other Designations
Hsp70-interacting protein|OTTHUMP00000028873|aging-associated protein 2|heat shock 70kD protein binding protein|progesterone receptor-associated p48 protein|putative tumor suppressor ST13
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com