SSR4 monoclonal antibody (M01), clone 2D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SSR4 monoclonal antibody (M01), clone 2D3 Western Blot analysis of SSR4 expression in C32 ( Cat # L002V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of SSR4 expression in transfected 293T cell line by SSR4 monoclonal antibody (M01), clone 2D3.
Lane 1: SSR4 transfected lysate(19 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SSR4 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SSR4 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (42.24 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SSR4.
Immunogen
SSR4 (AAH03371, 24 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EACLEPQITPSYYTTSDAVISTETVLIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.24 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SSR4 monoclonal antibody (M01), clone 2D3 Western Blot analysis of SSR4 expression in C32 ( Cat # L002V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SSR4 expression in transfected 293T cell line by SSR4 monoclonal antibody (M01), clone 2D3.
Lane 1: SSR4 transfected lysate(19 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SSR4 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SSR4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SSR4
Entrez GeneID
6748GeneBank Accession#
BC003371Protein Accession#
AAH03371Gene Name
SSR4
Gene Alias
TRAPD
Gene Description
signal sequence receptor, delta (translocon-associated protein delta)
Omim ID
300090Gene Ontology
HyperlinkGene Summary
SSR4, also called TRAPD, is assumed to be involved in protein secretion. It is located in the Xq28 region, arranged in a compact head-to-head manner with the IDH3G gene. These two genes are driven by a bidirectional promoter located between them, and encode proteins involved in unrelated biochemical pathways located in different compartments of the cell. The nontranscribed intergenic region represents only 133 bp and is embedded in a CpG island. The CpG island functions as a bidirectional promoter to initiate the transcription of both functionally unrelated genes with distinct expression patterns. SSR4 consists of six exons and is approximately 70 kb telomeric to the ALD gene. Although alternative splicing of exon 5 has not been detected in human SSR4, transcript variants missing the region homologous to human exon 5 have been detected in both Xenopus laevis and Mus musculus. [provided by RefSeq
Other Designations
OTTHUMP00000025956|OTTHUMP00000025957|OTTHUMP00000025958|signal sequence receptor, delta|translocon-associated protein delta
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com