Product Browser

Last updated: 2017/2/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SREBF2 polyclonal antibody (A01)

  • Catalog # : H00006721-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SREBF2.
  • Immunogen:
  • SREBF2 (AAH56158, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006721-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SREBF2 polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of SREBF2 expression in IMR-32 ( Cat # L008V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6721
  • Gene Name:
  • SREBF2
  • Gene Alias:
  • SREBP2,bHLHd2
  • Gene Description:
  • sterol regulatory element binding transcription factor 2
  • Gene Summary:
  • This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028740,sterol regulatory element-binding protein 2,sterol regulatory element-binding transcription factor 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook