SREBF1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SREBF1 partial ORF ( AAH57388, 801 a.a. - 900 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SREBF1
Entrez GeneID
6720GeneBank Accession#
BC057388Protein Accession#
AAH57388Gene Name
SREBF1
Gene Alias
SREBP-1c, SREBP1, bHLHd1
Gene Description
sterol regulatory element binding transcription factor 1
Omim ID
184756Gene Ontology
HyperlinkGene Summary
This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
sterol regulatory element binding protein-1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Palmitoylation-driven PHF2 ubiquitination remodels lipid metabolism through the SREBP1c axis in hepatocellular carcinoma.
Do-Won Jeong, Jong-Wan Park, Kyeong Seog Kim, Jiyoung Kim, June Huh, Jieun Seo, Ye Lee Kim, Joo-Youn Cho, Kwang-Woong Lee, Junji Fukuda, Yang-Sook Chun.
Nature Communications 2023 Oct; 14(1):6370.
Application:Pull-Down, Human, 293T cells.
-
Palmitoylation-driven PHF2 ubiquitination remodels lipid metabolism through the SREBP1c axis in hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com