AKR1D1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AKR1D1 full-length ORF ( NP_005980.1, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
63.8
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AKR1D1
Entrez GeneID
6718GeneBank Accession#
NM_005989.2Protein Accession#
NP_005980.1Gene Name
AKR1D1
Gene Alias
3o5bred, SRD5B1
Gene Description
aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
Omim ID
604741Gene Ontology
HyperlinkGene Summary
The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. [provided by RefSeq
Other Designations
aldo-keto reductase family 1, member D1|steroid 5-beta-reductase|steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
In vitro metabolism of a novel JNK inhibitor tanzisertib: interspecies differences in oxido-reduction and characterization of enzymes involved in metabolism.
Atsriku C, Hoffmann M, Moghaddam M, Kumar G, Surapaneni S.
Xenobiotica 2015 Jun; 45(6):465.
Application：Enzyme, Human, Tanzisertib were incubated in human liver microsomes, cytosol and hepatocytes.
-
In vitro metabolism of a novel JNK inhibitor tanzisertib: interspecies differences in oxido-reduction and characterization of enzymes involved in metabolism.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com