Product Browser

Last updated: 2017/4/30
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKR1D1 monoclonal antibody (M01), clone 1A6

  • Catalog # : H00006718-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant AKR1D1.
  • Immunogen:
  • AKR1D1 (NP_005980, 227 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • NPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AKR1D1 expression in transfected 293T cell line by AKR1D1 monoclonal antibody (M01), clone 1A6.

    Lane 1: AKR1D1 transfected lysate(37.4 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of AKR1D1 transfected lysate using anti-AKR1D1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AKR1D1 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6718
  • Gene Name:
  • AKR1D1
  • Gene Alias:
  • 3o5bred,SRD5B1
  • Gene Description:
  • aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
  • Gene Summary:
  • The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. [provided by RefSeq
  • Other Designations:
  • aldo-keto reductase family 1, member D1,steroid 5-beta-reductase,steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook