SRI monoclonal antibody (M01), clone 1E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SRI monoclonal antibody (M01), clone 1E12. Western Blot analysis of SRI expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
SRI monoclonal antibody (M01), clone 1E12. Western Blot analysis of SRI expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
SRI monoclonal antibody (M01), clone 1E12. Western Blot analysis of SRI expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
SRI monoclonal antibody (M01), clone 1E12 Western Blot analysis of SRI expression in HeLa ( Cat # L013V1 ).
Western Blot detection against Immunogen (47.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SRI.
Immunogen
SRI (AAH11025, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SRI monoclonal antibody (M01), clone 1E12. Western Blot analysis of SRI expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
SRI monoclonal antibody (M01), clone 1E12. Western Blot analysis of SRI expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
SRI monoclonal antibody (M01), clone 1E12. Western Blot analysis of SRI expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
SRI monoclonal antibody (M01), clone 1E12 Western Blot analysis of SRI expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SRI
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com