SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SRD5A1 expression in transfected 293T cell line (H00006715-T03) by SRD5A1 MaxPab polyclonal antibody.
Lane 1: SRD5A1 transfected lysate(29.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SRD5A1 protein.
Immunogen
SRD5A1 (NP_001038.1, 1 a.a. ~ 259 a.a) full-length human protein.
Sequence
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SRD5A1 expression in transfected 293T cell line (H00006715-T03) by SRD5A1 MaxPab polyclonal antibody.
Lane 1: SRD5A1 transfected lysate(29.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SRD5A1
Entrez GeneID
6715GeneBank Accession#
NM_001047.2Protein Accession#
NP_001038.1Gene Name
SRD5A1
Gene Alias
-
Gene Description
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Omim ID
184753Gene Ontology
HyperlinkGene Summary
Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM
Other Designations
3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1|5-alpha reductase|OTTHUMP00000115519|steroid 5-alpha-reductase type I|steroid-5-alpha-reductase 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Resistance exercise-induced increase in muscle 5α-dihydrotestosterone contributes to the activation of muscle Akt/mTOR/p70S6K- and Akt/AS160/GLUT4-signaling pathways in type 2 diabetic rats.
Naoki Horii, Natsuki Hasegawa, Shumpei Fujie, Masataka Uchida, Motoyuki Iemitsu.
FASEB Journal 2020 Aug; 34(8):11047.
Application：WB-Ti, Rat, Rat gastrocnemius muscles.
-
Increased Muscular 5α-Dihydrotestosterone in Response to Resistance Training Relates to Skeletal Muscle Mass and Glucose Metabolism in Type 2 Diabetic Rats.
Horii N, Sato K, Mesaki N, Iemitsu M.
PLoS One 2016 Nov; 11(11):e0165689.
Application：WB-Ti, Rat, Rat gastrocnemius muscle.
-
The Exercise-Induced Improvement in hyperglycemia is Mediated by DHT Produced in the Skeletal Muscle of Zucker Diabetic Fatty Rats.
Sato K, Fujita S, Yamauchi H, Shiroya Y, Kitamura H, Minato K, Iemitsu M.
Journal of Diabetes and Metabolism 2012 Dec; 4(1):239.
Application：WB-Ti, Rat, Gastrocnemius muscle.
-
Dihydrotestosterone synthesis bypasses testosterone to drive castration-resistant prostate cancer.
Chang KH, Li R, Papari-Zareei M, Watumull L, Zhao YD, Auchus RJ, Sharifi N.
PNAS 2011 Aug; 108(33):13728.
Application：WB-Ti, WB-Tr, Human, Mouse, LAPC4, LNCaP cells, Mouse tumors.
-
DHEA Administration Activates Local Bioactive Androgen Metabolism in Cancellous Site of Tibia of Ovariectomized Rats.
Park JH, Aizawa K, Iemitsu M, Sato K, Akimoto T, Agata U, Maeda S, Ezawa I, Omi N.
Calcified Tissue International 2011 Aug; 89(2):105.
Application：WB-Ti, Rat, Rat trabecular bone.
-
Resistance exercise-induced increase in muscle 5α-dihydrotestosterone contributes to the activation of muscle Akt/mTOR/p70S6K- and Akt/AS160/GLUT4-signaling pathways in type 2 diabetic rats.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com