SRC monoclonal antibody (M01), clone 1B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SRC.
Immunogen
SRC (AAH11566, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.90 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SRC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PTK2 and SRC. HeLa cells were stained with anti-PTK2 rabbit purified polyclonal 1:1200 and anti-SRC mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to SRC on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SRC
Entrez GeneID
6714GeneBank Accession#
BC011566Protein Accession#
AAH11566Gene Name
SRC
Gene Alias
ASV, SRC1, c-SRC, p60-Src
Gene Description
v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
Omim ID
190090Gene Ontology
HyperlinkGene Summary
This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000174476|OTTHUMP00000174477|proto-oncogene tyrosine-protein kinase SRC|protooncogene SRC, Rous sarcoma|tyrosine kinase pp60c-src|tyrosine-protein kinase SRC-1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com