SPRR3 monoclonal antibody (M01), clone 4A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant SPRR3.
Immunogen
SPRR3 (AAH17802, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK
Host
Mouse
Reactivity
Human
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.45 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SPRR3 expression in transfected 293T cell line by SPRR3 monoclonal antibody (M01), clone 4A12.
Lane 1: SPRR3 transfected lysate(18.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SPRR3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPRR3 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — SPRR3
-
Interactomes
-
Publication Reference
-
Comprehensive cornified envelope protein profile of odontogenic keratocysts clarifies the characteristics of non-keratinized oral epithelium.
Rita R Roy, Takanaga Ochiai, Katsumitsu Shimada, Hiromasa Hasegawa.
Journal of Oral Pathology & Medicine 2023 Sep; 52(8):758.
Application:IHC-P, Human, Dentigerous cysts, Odontogenic keratocyst.
-
Contribution of transglutaminases and their substrate proteins to the formation of cornified cell envelope in oral mucosal epithelium.
Rita Rani Roy, Katsumitsu Shimada, Satoshi Murakami, Hiromasa Hasegawa.
European journal of Oral Sciences 2021 Feb; 129(1):e12760.
Application:IHC-P, Human, Human mucosal samples.
-
Identification and evaluation of potential forensic marker proteins in vaginal fluid by liquid chromatography/mass spectrometry.
Igoh A, Doi Y, Sakurada K.
Analytical and Bioanalytical Chemistry 2015 Sep; 407(23):7135.
Application:ELISA, Human, Vaginal secretions, Nasal secretions, Saliva, Semen, Urine, Sweat.
-
Comprehensive cornified envelope protein profile of odontogenic keratocysts clarifies the characteristics of non-keratinized oral epithelium.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com