Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPI1 (Human) Recombinant Protein (P01)

  • Catalog # : H00006688-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SPI1 full-length ORF ( ENSP00000227163, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 56.8
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006688-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6688
  • Gene Name:
  • SPI1
  • Gene Alias:
  • OF,PU.1,SFPI1,SPI-1,SPI-A
  • Gene Description:
  • spleen focus forming virus (SFFV) proviral integration oncogene spi1
  • Gene Summary:
  • This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 31 kDa transforming protein,SPI-1 proto-oncogene,hematopoietic transcription factor PU.1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook