SPARC monoclonal antibody (M02), clone 1B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SPARC.
Immunogen
SPARC (AAH04974.1, 1 a.a. ~ 303 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (59.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SPARC monoclonal antibody (M02), clone 1B2. Western Blot analysis of SPARC expression in human kidney.Western Blot (Cell lysate)
SPARC monoclonal antibody (M02), clone 1B2 Western Blot analysis of SPARC expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SPARC expression in transfected 293T cell line by SPARC monoclonal antibody (M02), clone 1B2.
Lane 1: SPARC transfected lysate(34.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPARC is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — SPARC
Entrez GeneID
6678GeneBank Accession#
BC004974Protein Accession#
AAH04974.1Gene Name
SPARC
Gene Alias
ON
Gene Description
secreted protein, acidic, cysteine-rich (osteonectin)
Omim ID
182120Gene Ontology
HyperlinkGene Summary
Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM) (Bradshaw et al., 2003 [PubMed 12721366]).[supplied by OMIM
Other Designations
cysteine-rich protein|osteonectin|secreted protein, acidic, cysteine-rich
-
Interactome
-
Disease
-
Publication Reference
-
The matricellular protein SPARC supports follicular dendritic cell networking toward Th17 responses.
Piconese S, Costanza M, Tripodo C, Sangaletti S, Musio S, Pittoni P, Poliani PL, Burocchi A, Passafaro AL, Gorzanelli A, Vitali C, Chiodoni C, Barnaba V, Pedotti R, Colombo MP.
Journal of Autoimmunity 2011 Dec; 37(4):300.
Application:IF, IHC-P, Human, Mouse, Lymphnodes.
-
The matricellular protein SPARC supports follicular dendritic cell networking toward Th17 responses.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com