SPAM1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SPAM1.
Immunogen
SPAM1 (NP_003108, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag.
Sequence
RSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (64)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SPAM1
Entrez GeneID
6677GeneBank Accession#
NM_003117Protein Accession#
NP_003108Gene Name
SPAM1
Gene Alias
HYA1, HYAL1, HYAL3, HYAL5, MGC26532, PH-20, PH20, SPAG15
Gene Description
sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
Omim ID
600930Gene Ontology
HyperlinkGene Summary
Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene was previously referred to as HYAL1 and HYA1 and has since been assigned the official symbol SPAM1; another family member on chromosome 3p21.3 has been assigned HYAL1. This gene encodes a GPI-anchored enzyme located on the human sperm surface and inner acrosomal membrane. This multifunctional protein is a hyaluronidase that enables sperm to penetrate through the hyaluronic acid-rich cumulus cell layer surrounding the oocyte, a receptor that plays a role in hyaluronic acid induced cell signaling, and a receptor that is involved in sperm-zona pellucida adhesion. Abnormal expression of this gene in tumors has implicated this protein in degradation of basement membranes leading to tumor invasion and metastasis. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq
Other Designations
hyaluronoglucosaminidase|sperm adhesion molecule 1|sperm surface protein PH-20
-
Pathway
-
Disease
-
Publication Reference
-
Hyaluronan synthases and hyaluronidases in nasal polyps.
Panogeorgou T, Tserbini E, Filou S, Vynios DH, Naxakis SS, Papadas TA, Goumas PD, Mastronikolis NS.
European Archives of Oto-Rhino-Laryngology 2016 Jul; 273(7):1801.
Application:IHC-P, Human, Human nasal mucosa, nasal polyps.
-
The impact of oxidative stress on chaperone-mediated human sperm-egg interaction.
Bromfield EG, Aitken RJ, Anderson AL, McLaughlin EA, Nixon B.
Human Reproduction 2015 Nov; 30(11):2597.
Application:IF, PLA, Human, Sperm.
-
Expression of a functional recombinant oleosin-human hyaluronidase hPH-20 fusion in Arabidopsis thaliana.
Li H, Yang J, Chen Y, Guan L, Du L, Guo Y, Wang W, Wang L, Li H, Jiang C, Li X.
Protein Expression and Purificatio 2014 Nov; 103:23.
Application:WB-Ce, Plant, Arabidopsis thaliana.
-
Investigation of the mechanisms by which the molecular chaperone HSPA2 regulates the expression of sperm surface receptors involved in human sperm-oocyte recognition.
Redgrove KA, Anderson AL, McLaughlin EA, O'Bryan MK, Aitken RJ, Nixon B.
Molecular Human Reproduction 2012 Dec; 19(3):120.
Application:WB, IF, Flow Cyt, Human, Human spermatozoa.
-
Proteomic and functional analysis of human sperm detergent resistant membranes.
Ebert B, Kisiela M, Wsol V, Maser E.
Journal of Cellular Physiology 2011 Oct; 226(10):2651.
Application:IF, WB, Human, Human Sperm.
-
Autodisplay of catalytically active human hyaluronidase hPH-20 and testing of enzyme inhibitors.
KaeBler A, Olgen S, Jose J.
European Journal of Pharmaceutical Sciences 2011 Jan; 42(1-2):138.
Application:WB, Recombinant protein.
-
Hyaluronidase Expression and Activity Is Regulated by Pro-Inflammatory Cytokines in Human Airway Epithelial Cells.
Monzon ME, Manzanares D, Schmid N, Casalino-Matsuda SM, Forteza RM.
American Journal of Respiratory Cell and Molecular Biology 2008 Apr; 39(3):289.
-
Hyaluronan synthases and hyaluronidases in nasal polyps.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com