SP100 monoclonal antibody (M02), clone 1G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SP100.
Immunogen
SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SP100 expression in transfected 293T cell line by SP100 monoclonal antibody (M02), clone 1G6.
Lane 1: SP100 transfected lysate(100.417 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SP100 is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of SP100 over-expressed 293 cell line, cotransfected with SP100 Validated Chimera RNAi ( Cat # H00006672-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SP100 monoclonal antibody (M02), clone 1G6 (Cat # H00006672-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — SP100
-
Interactome
-
Disease
-
Publication Reference
-
Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection.
Berard AR, Coombs KM, Severini A.
Journal of Proteome Research 2015 May; 14(5):2121.
Application:WB, Human, HEK293 cells.
-
Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com