SOX12 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SOX12 polyclonal antibody (A01), Lot # 051004JC01 Western Blot analysis of SOX12 expression in HepG2 ( Cat # L019V1 ).
Western Blot detection against Immunogen (32.93 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SOX12.
Immunogen
SOX12 (NP_008874, 252 a.a. ~ 313 a.a) partial recombinant protein with GST tag.
Sequence
LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.93 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SOX12 polyclonal antibody (A01), Lot # 051004JC01 Western Blot analysis of SOX12 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SOX12
Entrez GeneID
6666GeneBank Accession#
NM_006943Protein Accession#
NP_008874Gene Name
SOX12
Gene Alias
SOX22
Gene Description
SRY (sex determining region Y)-box 12
Omim ID
601947Gene Ontology
HyperlinkGene Summary
Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq
Other Designations
SOX-22 protein|SRY (sex determining region Y)-box 22|SRY-related HMG-box gene 22
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com