SOX10 monoclonal antibody (M01), clone 1E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SOX10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SOX10.
Immunogen
SOX10 (NP_008872, 336 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SOX10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]ELISA
-
Gene Info — SOX10
Entrez GeneID
6663GeneBank Accession#
NM_006941Protein Accession#
NP_008872Gene Name
SOX10
Gene Alias
DOM, MGC15649, WS2E, WS4
Gene Description
SRY (sex determining region Y)-box 10
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. [provided by RefSeq
Other Designations
OTTHUMP00000028515|OTTHUMP00000195094|SRY-related HMG-box gene 10|dominant megacolon, mouse, human homolog of
-
Interactome
-
Disease
-
Publication Reference
-
Cutaneous PEComa does not harbor TFE3 gene fusions. Immunohistochemical and molecular study of 17 cases.
Llamas-Velasco M, Mentzel T, Requena L, Palmedo G, Kasten R, Kutzner H.
Histopathology 2013 Jul; 63(1):122.
Application：IHC-P, Human, Human perivascular epithelioid cell tumors.
-
Histopathological study of the treatment of melasma lesions using a low-fluence Q-switched 1064-nm neodymium:yttrium-aluminium-garnet laser.
Kim JE, Chang SE, Yeo UC, Haw S, Kim IH.
Clinical and Experimental Dermatology 2013 Mar; 38(2):167.
Application：IHC, Human, Skin.
-
Cutaneous PEComa does not harbor TFE3 gene fusions. Immunohistochemical and molecular study of 17 cases.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com