Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOX9 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006662-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SOX9 partial ORF ( NP_000337, 400 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006662-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6662
  • Gene Name:
  • SOX9
  • Gene Alias:
  • CMD1,CMPD1,SRA1
  • Gene Description:
  • SRY (sex determining region Y)-box 9
  • Gene Summary:
  • The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq
  • Other Designations:
  • SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal),SRY (sex-determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal),SRY (sex-determining region Y)-box 9 protein,campomelic dysplasia, autosomal sex-revers
  • RSS
  • YouTube
  • Linkedin
  • Facebook