SOX9 monoclonal antibody (M04), clone 3F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SOX9.
Immunogen
SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SOX9 monoclonal antibody (M04), clone 3F11 Western Blot analysis of SOX9 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SOX9 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — SOX9
Entrez GeneID
6662GeneBank Accession#
NM_000346Protein Accession#
NP_000337Gene Name
SOX9
Gene Alias
CMD1, CMPD1, SRA1
Gene Description
SRY (sex determining region Y)-box 9
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq
Other Designations
SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 protein|campomelic dysplasia, autosomal sex-revers
-
Interactome
-
Disease
-
Publication Reference
-
Gli1 expression in cancer stem-like cells predicts poor prognosis in patients with lung squamous cell carcinoma.
Cui Y, Cui CA, Yang ZT, Ni WD, Jin Y, Xuan YH.
Amino Acids 2017 Mar; 102(2):347.
Application:IHC-P, Human, Human lung squamous cell carcinoma.
-
Pathological characteristics of intraductal polypoid neoplasms of bile ducts in Thailand.
Nitta T, Nakanuma Y, Sato Y, Hirano S, Pairojkul C.
International Journal of Clinical and Experimental Pathology 2015 Jul; 8(7):8284.
Application:IHC-P, Human, Biliary neoplasm.
-
Gli1 expression in cancer stem-like cells predicts poor prognosis in patients with lung squamous cell carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com