SOX9 monoclonal antibody (M02), clone 3C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SOX9.
Immunogen
SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SOX9 monoclonal antibody (M02), clone 3C10 Western Blot analysis of SOX9 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M02), clone 3C10.
Lane 1: SOX9 transfected lysate(56.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7 ug/ml]Immunoprecipitation
Immunoprecipitation of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SOX9 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SOX9 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — SOX9
Entrez GeneID
6662GeneBank Accession#
NM_000346Protein Accession#
NP_000337Gene Name
SOX9
Gene Alias
CMD1, CMPD1, SRA1
Gene Description
SRY (sex determining region Y)-box 9
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq
Other Designations
SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 protein|campomelic dysplasia, autosomal sex-revers
-
Interactome
-
Disease
-
Publication Reference
-
BAF complex maintains glioma stem cells in pediatric H3K27M-glioma.
Eshini Panditharatna, Joana G Marques, Tingjian Wang, Maria C Trissal, Ilon Liu, Li Jiang, Alexander Beck, Andrew Groves, Neekesh V Dharia, Deyao Li, Samantha E Hoffman, Guillaume Kugener, McKenzie L Shaw, Hafsa M Mire, Olivia A Hack, Joshua M Dempster, Caleb Lareau, Lingling Dai, Logan H Sigua, Michael A Quezada, Ann-Catherine J Stanton, Meghan Wyatt, Zohra Kalani, Amy Goodale, Francisca Vazquez, Federica Piccioni, John G Doench, David E Root, Jamie N Anastas, Kristen L Jones, Amy Saur Conway,
Cancer Discovery 2022 Oct; CD21:1491.
Application:IF, Human, BT869 cells.
-
SOX9+/PTF1A+ Cells Define the Tip Progenitor Cells of the Human Fetal Pancreas of the Second Trimester.
Villani V, Thornton ME, Zook HN, Crook CJ, Grubbs BH, Orlando G, De Filippo R, Ku HT, Perin L.
Stem Cells Translational Medicine 2019 Dec; 8(12):1249.
Application:IHC-P, Human, Human fetal pancreas.
-
The Influence of TGF-β3, EGF, and BGN on SOX9 and RUNX2 Expression in Human Chondrogenic Progenitor Cells.
Janssen JN, Batschkus S, Schimmel S, Bode C, Schminke B, Miosge N.
The Journal of Histochemistry and Cytochemistry: Official Journal of the Histochemistry Society 2018 Nov; 22155418811645.
Application:WB, Human, Human chondrogenic progenitor cells.
-
GLI1 promotes cancer stemness through intracellular signaling pathway PI3K/Akt/NFκB in colorectal adenocarcinoma.
Yang Z, Zhang C, Qi W, Xuan Y, Cui Y.
Experimental Cell Research 2018 Dec; 373(1-2):145.
Application:IF, IHC-P, WB, Human, HCT-116, HT-29 cells, Human colorectal adenocarcinoma.
-
In vitro osteogenic potential of human bone marrow derived MSCs is predicted by Runx2/Sox9 Ratio.
Loebel C, Czekanska E, Bruderer M, Salzmann GM, Alini M PhD, Stoddart MJ.
Tissue Engineering. Part A 2015 Jan; 21(1-2):115.
Application:WB-Tr, Human, MSCs.
-
Expression of cancer stem cell markers is more frequent in anaplastic thyroid carcinoma compared to papillary thyroid carcinoma and is related to adverse clinical outcome.
Yun JY, Kim YA, Choe JY, Min H, Lee KS, Jung Y, Oh S, Kim JE.
Journal of Clinical Pathology 2014 Feb; 67(2):125.
Application:IHC, Human, Thyroid.
-
Supra- and infratentorial pediatric ependymomas differ significantly in NeuN, p75 and GFAP expression.
Hagel C, Treszl A, Fehlert J, Harder J, von Haxthausen F, Kern M, von Bueren AO, Kordes U.
Journal of Neuro-Oncology 2013 Jan; 112(2):191.
Application:IHC-P, Human, Ependymomas.
-
A Molecular Profile of Focal Segmental Glomerulosclerosis from Formalin-Fixed, Paraffin-Embedded Tissue.
Hodgin JB, Borczuk AC, Nasr SH, Markowitz GS, Nair V, Martini S, Eichinger F, Vining C, Berthier CC, Kretzler M, D'Agati VD.
The American Journal of Pathology 2010 Sep; 177(4):1674.
Application:IHC-P, Human, Human normal kidney.
-
BAF complex maintains glioma stem cells in pediatric H3K27M-glioma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com