SOX9 monoclonal antibody (M01), clone 2A2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SOX9.
Immunogen
SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M01), clone 2A2.
Lane 1: SOX9 transfected lysate(63.639 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SOX9 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SOX9
Entrez GeneID
6662GeneBank Accession#
NM_000346Protein Accession#
NP_000337Gene Name
SOX9
Gene Alias
CMD1, CMPD1, SRA1
Gene Description
SRY (sex determining region Y)-box 9
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq
Other Designations
SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)|SRY (sex-determining region Y)-box 9 protein|campomelic dysplasia, autosomal sex-revers
-
Interactome
-
Disease
-
Publication Reference
-
LCRMP-1 is required for spermatogenesis and stabilises spermatid F-actin organization via the PI3K-Akt pathway.
Jung-Hsuan Chang, Chia-Hua Chou, Jui-Ching Wu, Keng-Mao Liao, Wei-Jia Luo, Wei-Lun Hsu, Xuan-Ren Chen, Sung-Liang Yu, Szu-Hua Pan, Pan-Chyr Yang, Kang-Yi Su.
Communications Biology 2023 Apr; 6(1):389.
Application:IF, Mouse, Mouse seminiferous tubules .
-
Functional Analysis of Mmd2 and Related PAQR Genes During Sex Determination in Mice.
Liang Zhao, Ella Thomson, Ee T Ng, Enya Longmuss, Terje Svingen, Stefan Bagheri-Fam, Alexander Quinn, Vincent R Harley, Leonard C Harrison, Emanuele Pelosi, Peter Koopman.
Sexual Development 2022 Mar; 1:13.
Application:IF, Mouse, Mouse fetal gonads.
-
Tenascin-C is involved in promotion of cancer stemness via the Akt/HIF1α axis in esophageal squamous cell carcinoma.
Yang Z, Zhang C, Feng Y, Qi W, Cui Y, Xuan Y.
Experimental and Molecular Pathology 2019 Aug; 109:104239.
Application:IHC-P, Human, Human esophageal squamous cell carcinoma.
-
SOX4 regulates gonad morphogenesis and promotes male germ cell differentiation in mice.
Zhao L, Arsenault M, Ng ET, Longmuss E, Chau TC, Hartwig S, Koopman P.
Developmental Biology 2017 Mar; 423(1):46.
Application:IF, Mouse, Mouse fetal testes.
-
Germ cells influence cord formation and Leydig cell gene expression during mouse testis development.
Rios-Rojas C, Spiller C, Bowles J, Koopman P.
Developmental Dynamics 2016 Apr; 245(4):433.
Application:IF, Mouse, Sertoli cell.
-
Primary cilia function regulates the length of the embryonic trunk axis and urogenital field in mice.
Wainwright EN, Svingen T, Ng ET, Wicking C, Koopman P.
Developmental Biology 2014 Nov; 395(2):342.
Application:IF, Mouse, Testis, Ovary.
-
LCRMP-1 is required for spermatogenesis and stabilises spermatid F-actin organization via the PI3K-Akt pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com