SOX4 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SOX4.
Immunogen
SOX4 (NP_003098, 45 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Sequence
KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.23 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SOX4
Entrez GeneID
6659GeneBank Accession#
NM_003107Protein Accession#
NP_003098Gene Name
SOX4
Gene Alias
EVI16
Gene Description
SRY (sex determining region Y)-box 4
Omim ID
184430Gene Ontology
HyperlinkGene Summary
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. [provided by RefSeq
Other Designations
OTTHUMP00000039358|SRY-related HMG-box gene 4|ecotropic viral integration site 16
-
Interactome
-
Publication Reference
-
SOX4 promotes the growth and metastasis of breast cancer.
Jing Zhang, Chunhua Xiao, Zhenbo Feng, Yun Gong, Baohua Sun, Zhongqi Li, Yimin Lu, Xiaojie Fei, Weizhu Wu, Xiaoping Sun, Lisong Teng.
Cancer Cell International 2020 Sep; 20:468.
Application:WB-Ce, WB-Tr, Human, HEK 293T, BT474, MDA-MB-231, SUM149 cells.
-
A Quantitative Proteomic Analysis Uncovers the Relevance of CUL3 in Bladder Cancer Aggressiveness.
Grau L, Luque-Garcia JL, Gonzalez-Peramato P, Theodorescu D, Palou J, Fernandez-Gomez JM, Sanchez-Carbayo M.
PLoS One 2013 Jan; 8(1):e53328.
Application:WB, Human, Bladder cancer cells T24, T26T.
-
SOX4 promotes the growth and metastasis of breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com