Product Browser

Last updated: 2017/7/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOS1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006654-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SOS1 partial ORF ( NP_005624, 313 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006654-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6654
  • Gene Name:
  • SOS1
  • Gene Alias:
  • GF1,GGF1,GINGF,HGF,NS4
  • Gene Description:
  • son of sevenless homolog 1 (Drosophila)
  • Gene Summary:
  • This gene encodes a protein that is a guanine nucleotide exchange factor for RAS proteins, membrane proteins that bind guanine nucleotides and participate in signal transduction pathways. GTP binding activates and GTP hydrolysis inactivates RAS proteins. The product of this gene may regulate RAS proteins by facilitating the exchange of GTP for GDP. Mutations in this gene are associated with gingival fibromatosis 1 and Noonan syndrome type 4. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000128306,gingival fibromatosis, hereditary, 1,guanine nucleotide exchange factor,son of sevenless homolog 1
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook