Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOAT1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006646-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SOAT1 partial ORF ( NP_003092.4, 249 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.77
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006646-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6646
  • Gene Name:
  • SOAT1
  • Gene Alias:
  • ACACT,ACAT,ACAT1,RP11-215I23.2,SOAT,STAT
  • Gene Description:
  • sterol O-acyltransferase 1
  • Gene Summary:
  • Acyl-coenzyme A:cholesterol acyltransferase (ACACT; EC 2.3.1.26) is an intracellular protein located in the endoplasmic reticulum that forms cholesterol esters from cholesterol. Accumulation of cholesterol esters as cytoplasmic lipid droplets within macrophages and smooth muscle cells is a characteristic feature of the early stages of atherosclerotic plaques (Cadigan et al., 1988 [PubMed 3335499]).[supplied by OMIM
  • Other Designations:
  • acyl-Coenzyme A: cholesterol acyltransferase,sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook