Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNTB2 (Human) Recombinant Protein (P01)

  • Catalog # : H00006645-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SNTB2 full-length ORF ( ENSP00000353686, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRQN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 54.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006645-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6645
  • Gene Name:
  • SNTB2
  • Gene Alias:
  • D16S2531E,EST25263,SNT2B2,SNT3,SNTL
  • Gene Description:
  • syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
  • Gene Summary:
  • Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq
  • Other Designations:
  • basic beta 2 syntrophin,dystrophin-associated protein A1, 59kD, basic component 2,syntrophin, beta 2 (dystrophin-associated protein A1, 59kD, basic component 2),syntrophin-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook