SNTB2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SNTB2 full-length ORF ( ENSP00000353686, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRQN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
54.1
Interspecies Antigen Sequence
Mouse (94); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SNTB2
Entrez GeneID
6645GeneBank Accession#
ENST00000360496Protein Accession#
ENSP00000353686Gene Name
SNTB2
Gene Alias
D16S2531E, EST25263, SNT2B2, SNT3, SNTL
Gene Description
syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
Omim ID
600027Gene Ontology
HyperlinkGene Summary
Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq
Other Designations
basic beta 2 syntrophin|dystrophin-associated protein A1, 59kD, basic component 2|syntrophin, beta 2 (dystrophin-associated protein A1, 59kD, basic component 2)|syntrophin-like
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com