SNTB2 monoclonal antibody (M01), clone 3F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNTB2 is 0.3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SNTB2.
Immunogen
SNTB2 (NP_006741.1, 116 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNTB2 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SNTB2
Entrez GeneID
6645GeneBank Accession#
NM_006750Protein Accession#
NP_006741.1Gene Name
SNTB2
Gene Alias
D16S2531E, EST25263, SNT2B2, SNT3, SNTL
Gene Description
syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
Omim ID
600027Gene Ontology
HyperlinkGene Summary
Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq
Other Designations
basic beta 2 syntrophin|dystrophin-associated protein A1, 59kD, basic component 2|syntrophin, beta 2 (dystrophin-associated protein A1, 59kD, basic component 2)|syntrophin-like
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com