Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNRPD1 (Human) Recombinant Protein (P01)

  • Catalog # : H00006632-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SNRPD1 full-length ORF (NP_008869.1, 1 a.a. - 119 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
  • Theoretical MW (kDa):
  • 39.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00006632-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6632
  • Gene Name:
  • SNRPD1
  • Gene Alias:
  • HsT2456,SMD1,SNRPD
  • Gene Description:
  • small nuclear ribonucleoprotein D1 polypeptide 16kDa
  • Gene Summary:
  • This gene encodes a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA. [provided by RefSeq
  • Other Designations:
  • Sm-D autoantigen,small nuclear ribonucleoprotein D1 polypeptide (16kD),snRNP core protein D1
  • RSS
  • YouTube
  • Linkedin
  • Facebook