Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNRPB purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00006628-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SNRPB protein.
  • Immunogen:
  • SNRPB (NP_937859.1, 1 a.a. ~ 240 a.a) full-length human protein.
  • Sequence:
  • MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SNRPB expression in transfected 293T cell line (H00006628-T02) by SNRPB MaxPab polyclonal antibody.

    Lane 1: SNRPB transfected lysate(24.60 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6628
  • Gene Name:
  • SNRPB
  • Gene Alias:
  • COD,SNRPB1,SmB/SmB',snRNP-B
  • Gene Description:
  • small nuclear ribonucleoprotein polypeptides B and B1
  • Gene Summary:
  • The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. [provided by RefSeq
  • Other Designations:
  • B polypeptide of Sm protein,OTTHUMP00000030012,OTTHUMP00000030013,Sm protein B/B',small nuclear ribonucleoprotein polypeptide B,small nuclear ribonucleoprotein polypeptide B/B',small nuclear ribonucleoprotein polypeptides B and B'
  • RSS
  • YouTube
  • Linkedin
  • Facebook