Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNRPB polyclonal antibody (A01)

  • Catalog # : H00006628-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SNRPB.
  • Immunogen:
  • SNRPB (NP_003082, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006628-A01
    Western Blot detection against Immunogen (34.91 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6628
  • Gene Name:
  • SNRPB
  • Gene Alias:
  • COD,SNRPB1,SmB/SmB',snRNP-B
  • Gene Description:
  • small nuclear ribonucleoprotein polypeptides B and B1
  • Gene Summary:
  • The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. [provided by RefSeq
  • Other Designations:
  • B polypeptide of Sm protein,OTTHUMP00000030012,OTTHUMP00000030013,Sm protein B/B',small nuclear ribonucleoprotein polypeptide B,small nuclear ribonucleoprotein polypeptide B/B',small nuclear ribonucleoprotein polypeptides B and B'
  • RSS
  • YouTube
  • Linkedin
  • Facebook