Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNCG (Human) Recombinant Protein (P01)

  • Catalog # : H00006623-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SNCG full-length ORF ( AAH14098.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006623-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6623
  • Gene Name:
  • SNCG
  • Gene Alias:
  • BCSG1,SR
  • Gene Description:
  • synuclein, gamma (breast cancer-specific protein 1)
  • Gene Summary:
  • Summary: This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020013,breast cancer-specific protein 1,persyn,synoretin,synuclein, gamma (breast cancer-specific gene 1)
  • RSS
  • YouTube
  • Linkedin
  • Facebook