SNCG monoclonal antibody (M01A), clone 2C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SNCG.
Immunogen
SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SNCG monoclonal antibody (M01A), clone 2C3. Western Blot analysis of SNCG expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of SNCG expression in transfected 293T cell line by SNCG monoclonal antibody (M01A), clone 2C3.
Lane 1: SNCG transfected lysate(13.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — SNCG
Entrez GeneID
6623GeneBank Accession#
BC014098Protein Accession#
AAH14098Gene Name
SNCG
Gene Alias
BCSG1, SR
Gene Description
synuclein, gamma (breast cancer-specific protein 1)
Omim ID
602998Gene Ontology
HyperlinkGene Summary
Summary: This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq
Other Designations
OTTHUMP00000020013|breast cancer-specific protein 1|persyn|synoretin|synuclein, gamma (breast cancer-specific gene 1)
-
Interactome
-
Disease
-
Publication Reference
-
Characterization and staging of outer plexiform layer development in human retina and retinal organoids.
Sumitha Prameela Bharathan, Angela Ferrario, Kayla Stepanian, G Esteban Fernandez, Mark W Reid, Justin S Kim, Chloe Hutchens, Narine Harutyunyan, Carolyn Marks, Matthew E Thornton, Brendan H Grubbs, David Cobrinik, Jennifer G Aparicio, Aaron Nagiel.
Development 2021 Dec; 148(23):199551.
Application:IF, Human, Human fetal retina, WTC11, H9 cells (Human retinal organoid).
-
Single-Cell Transcriptomic Comparison of Human Fetal Retina, hPSC-Derived Retinal Organoids, and Long-Term Retinal Cultures.
Sridhar A, Hoshino A, Finkbeiner CR, Chitsazan A, Dai L, Haugan AK, Eschenbacher KM, Jackson DL, Trapnell C, Bermingham-McDonogh O, Glass I, Reh TA.
Cell Reports 2020 Feb; 30(5):1644.
Application:IF, Human, Human retina.
-
Characterization and staging of outer plexiform layer development in human retina and retinal organoids.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com