Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNCG purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00006623-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SNCG protein.
  • Immunogen:
  • SNCG (AAH14098.1, 1 a.a. ~ 127 a.a) full-length human protein.
  • Sequence:
  • MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SNCG expression in transfected 293T cell line (H00006623-T01) by SNCG MaxPab polyclonal antibody.

    Lane 1: SNCG transfected lysate(13.30 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6623
  • Gene Name:
  • SNCG
  • Gene Alias:
  • BCSG1,SR
  • Gene Description:
  • synuclein, gamma (breast cancer-specific protein 1)
  • Gene Summary:
  • Summary: This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020013,breast cancer-specific protein 1,persyn,synoretin,synuclein, gamma (breast cancer-specific gene 1)
  • RSS
  • YouTube
  • Linkedin
  • Facebook