SNCA purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SNCA protein.
Immunogen
SNCA (NP_000336.1, 1 a.a. ~ 140 a.a) full-length human protein.
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SNCA expression in transfected 293T cell line (H00006622-T02) by SNCA MaxPab polyclonal antibody.
Lane 1: SNCA transfected lysate(14.50 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between SNCA and APP. HeLa cells were stained with anti-SNCA rabbit purified polyclonal 1:1200 and anti-APP mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — SNCA
Entrez GeneID
6622GeneBank Accession#
NM_000345Protein Accession#
NP_000336.1Gene Name
SNCA
Gene Alias
MGC110988, NACP, PARK1, PARK4, PD1
Gene Description
synuclein, alpha (non A4 component of amyloid precursor)
Gene Ontology
HyperlinkGene Summary
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Four alternatively spliced transcripts encoding two different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000161559|OTTHUMP00000161561|alpha synuclein|alpha-synuclein|alpha-synuclein, isoform NACP140|non A-beta component of AD amyloid|non A4 component of amyloid
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com