Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNCA polyclonal antibody (A01)

  • Catalog # : H00006622-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant SNCA.
  • Immunogen:
  • SNCA (AAH13293.1, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006622-A01
    Western Blot detection against Immunogen (41.51 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6622
  • Gene Name:
  • SNCA
  • Gene Alias:
  • MGC110988,NACP,PARK1,PARK4,PD1
  • Gene Description:
  • synuclein, alpha (non A4 component of amyloid precursor)
  • Gene Summary:
  • Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Four alternatively spliced transcripts encoding two different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000161559,OTTHUMP00000161561,alpha synuclein,alpha-synuclein,alpha-synuclein, isoform NACP140,non A-beta component of AD amyloid,non A4 component of amyloid
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook