Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNAI1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006615-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SNAI1 partial ORF ( NP_005976.2, 121 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006615-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6615
  • Gene Name:
  • SNAI1
  • Gene Alias:
  • SLUGH2,SNA,SNAH,dJ710H13.1
  • Gene Description:
  • snail homolog 1 (Drosophila)
  • Gene Summary:
  • The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031680,snail 1 homolog,snail 1 zinc finger protein,snail 1, zinc finger protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook