SNAI1 monoclonal antibody (M41), clone 1A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SNAI1 expression in transfected 293T cell line by SNAI1 monoclonal antibody (M41), clone 1A5.
Lane 1: SNAI1 transfected lysate(29.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of SNAI1 transfected lysate using anti-SNAI1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SNAI1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNAI1 is 0.3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SNAI1.
Immunogen
SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SNAI1 expression in transfected 293T cell line by SNAI1 monoclonal antibody (M41), clone 1A5.
Lane 1: SNAI1 transfected lysate(29.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of SNAI1 transfected lysate using anti-SNAI1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SNAI1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNAI1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SNAI1
Entrez GeneID
6615GeneBank Accession#
NM_005985Protein Accession#
NP_005976.2Gene Name
SNAI1
Gene Alias
SLUGH2, SNA, SNAH, dJ710H13.1
Gene Description
snail homolog 1 (Drosophila)
Omim ID
604238Gene Ontology
HyperlinkGene Summary
The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq
Other Designations
OTTHUMP00000031680|snail 1 homolog|snail 1 zinc finger protein|snail 1, zinc finger protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com