Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNAI1 monoclonal antibody (M10), clone 2G11

  • Catalog # : H00006615-M10
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SNAI1.
  • Immunogen:
  • SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006615-M10
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence of monoclonal antibody to SNAI1 on U-2 OS cell. [antibody concentration 10 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SNAI1 is approximately 0.3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Immunofluorescence (Circulating Tumor Cell)
  • Immunofluorescence (Circulating Tumor Cell)
  • HCC36 cells were stained with SNAI1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Immunofluorescence (Circulating Tumor Cell)
  • Immunofluorescence (Circulating Tumor Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6615
  • Gene Name:
  • SNAI1
  • Gene Alias:
  • SLUGH2,SNA,SNAH,dJ710H13.1
  • Gene Description:
  • snail homolog 1 (Drosophila)
  • Gene Summary:
  • The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031680,snail 1 homolog,snail 1 zinc finger protein,snail 1, zinc finger protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook